PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29848.m004539
Common NameRCOM_0920910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 372aa    MW: 41142.9 Da    PI: 8.5395
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29848.m004539genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.33.3e-2868125259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dgy+WrKYGqK+vk+s+  rsYYrC++++C++kkkv+r+++ ++v++++Y g+Hnh+
  29848.m004539  68 TDGYSWRKYGQKQVKSSRSFRSYYRCSHSNCHAKKKVQRCDQSGQVIDTVYIGQHNHD 125
                    7********************************************************7 PP

2WRKY89.82.3e-28233290259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dg++WrKYGqK+vk + + rsYYrCtsagCp++k+ve + +d ++++i+Yeg+H+h+
  29848.m004539 233 SDGFRWRKYGQKMVKANSYLRSYYRCTSAGCPSRKHVEMAIDDARTTTIKYEGKHDHD 290
                    7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.3962127IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-2662125IPR003657WRKY domain
SuperFamilySSF1182906.15E-2565126IPR003657WRKY domain
SMARTSM007741.8E-3067126IPR003657WRKY domain
PfamPF031064.1E-2369125IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-27221292IPR003657WRKY domain
PROSITE profilePS5081128.518227292IPR003657WRKY domain
SuperFamilySSF1182905.75E-24228292IPR003657WRKY domain
SMARTSM007745.0E-31232291IPR003657WRKY domain
PfamPF031063.8E-22234289IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MVSTKPRVSE AQFELPAECT NPSTNISSLA PATISISHSA PVIQKHLLTE NIDRITSHPR  60
IVMESPATDG YSWRKYGQKQ VKSSRSFRSY YRCSHSNCHA KKKVQRCDQS GQVIDTVYIG  120
QHNHDLSQNK CNISRGSASS AKLTASSHIV DSDNKVDNAD VSICWEDGRQ SSLHMTESEQ  180
QSSSSSNGNF GIKGEEQNGT ELESSKFVYL APVLKATKDT NIVVHAADGA MSSDGFRWRK  240
YGQKMVKANS YLRSYYRCTS AGCPSRKHVE MAIDDARTTT IKYEGKHDHD MPVPRKQKGS  300
KSLVHNSPPA NANAAHCKKT SNLSSQRFSS STEWAVDREE NMMDEKVLEL GGEMALESAQ  360
TLLSIGTELR PC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-2254292174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572562.10.0PREDICTED: probable WRKY transcription factor 32
TrEMBLB9RNV80.0B9RNV8_RICCO; WRKY transcription factor, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16159610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.14e-53WRKY DNA-binding protein 32